Maalaga Blogger Template

Science Stupidity Serendipity and Salavation

Protein Talk© Game

1 Response to Protein Talk© Game

Wed Apr 14, 09:09:00 AM

>gi|59939423|gb|AAX12445.1| peroxisomal targeting signal-2 receptor [Leishmania major]
MPSFQMHPG{FAG}Q{SIR}TNPWKPTQFIISTSQNFGIVGSGKAYVVEAAPGFQAGSPVSLVGCWGTSDGVFD
ACFSEVDQNIVVTACGDGVKVYNLAMSLNRDGVIPLVHNAEHQAEVSCVTWNSAHRDTFYSASWDTTIKM
YSAVKPEVSMVTMQEHFKEVYE{VAST}AHSPSSILSCSGDGSWKLWDNRSPQRSVLTQMAHQNQIVLSIDF
CKSDPNIFASGGVDRTVRVWDARRPNQPLASFPGHDQACRRVRFSTHNPSMLASSGYDMRVCVWDLSKPQ
QPLTARYQHHREFVAGLEWSQAAPNALASASYDGSAFFWSVGQAATPSLPTQQLPPAVPPPRVPRPRTKV
{LAG}LPQPSMPMPMAVTSPPRSPR

Words in the protein - Fag, Sir, Vast, Lag

Yuck… My favorite protein scores so meager.. just 5 :-(

But it says “Sir, There is a Vast Fag Lag..!”

Post a Comment